ATP6V1F, Recombinant, Human, aa1-119, GST-Tag (V-type Proton ATPase Subunit F)

Catalog Number: USB-372390
Article Name: ATP6V1F, Recombinant, Human, aa1-119, GST-Tag (V-type Proton ATPase Subunit F)
Biozol Catalog Number: USB-372390
Supplier Catalog Number: 372390
Alternative Catalog Number: USB-372390-20,USB-372390-100
Manufacturer: US Biological
Category: Molekularbiologie
Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. Source: Recombinant protein corresponding to aa1-119 from human ATP6V1F, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.4kD Amino Acid Sequence: MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 40.4
UniProt: Q16864
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.