B9D2, Recombinant, Human, aa1-175, GST-Tag (B9 Domain-containing Protein 2)
Biozol Catalog Number:
USB-372400
Supplier Catalog Number:
372400
Alternative Catalog Number:
USB-372400-20,USB-372400-100,USB-372400-1
Manufacturer:
US Biological
Category:
Molekularbiologie
Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. Source: Recombinant protein corresponding to aa1-175 from human B9D2, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~46.3kD Amino Acid Sequence: MAEVHVIGQIIGASGFSESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFATKGLQGWPRLHFQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLACPTWRPLGSWREQLARAFVGGGPQLLHGDTIYSGADRYRLHTAAGGTVHLEIGLLLRNFDRYGVEC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted