BCL2L14, Recombinant, Human, aa1-327, GST-Tag (Apoptosis Facilitator Bcl-2-like Protein 14)

Product Overview

• Article Name: BCL2L14, Recombinant, Human, aa1-327, GST-Tag (Apoptosis Facilitator Bcl-2-like Protein 14)
• Biozol Catalog Number: USB-372424
• Supplier Catalog Number: 372424
• Alternative Catalog Number: USB-372424-20, USB-372424-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Plays a role in apoptosis. Source: Recombinant protein corresponding to aa1-327 from human BCL2L14, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~63.6kD Amino Acid Sequence: MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 63.6
• UniProt: Q9BZR8
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.