BCL2L2, Recombinant, Human, aa2-193, His-SUMO-Tag (Bcl-2-like Protein 2)
Biozol Catalog Number:
USB-372426
Supplier Catalog Number:
372426
Alternative Catalog Number:
USB-372426-20, USB-372426-100, USB-372426-1
Manufacturer:
US Biological
Category:
Molekularbiologie
Promotes cell survival. Blocks dexamethasone-induced apoptosis. Mediates survival of postmitotic Sertoli cells by suppressing death-promoting activity of BAX. Source: Recombinant protein corresponding to aa2-193 from human BCL2L2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.6kD Amino Acid Sequence: ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted