BDNF, Recombinant, Rat, aa136-243, His-Tag (Brain-derived Neurotrophic Factor)

Catalog Number: USB-372432
Article Name: BDNF, Recombinant, Rat, aa136-243, His-Tag (Brain-derived Neurotrophic Factor)
Biozol Catalog Number: USB-372432
Supplier Catalog Number: 372432
Alternative Catalog Number: USB-372432-20,USB-372432-100
Manufacturer: US Biological
Category: Molekularbiologie
During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. Source: Recombinant protein corresponding to aa136-243 from rat Bdnf, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~16.4kD Amino Acid Sequence: RRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 16.4
UniProt: P23363
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.