Mammal beta-toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the activation voltage to more negative potentials. This toxin is active against mammals. Source: Recombinant protein corresponding to aa17-82 from centruroides noxius Beta-mammal Toxin Cn2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~9.6kD Amino Acid Sequence: KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted
