BETVIA, Recombinant, Betula Pendula, aa2-160, His-SUMO-Tag (Major Pollen Allergen Bet v 1-A)

Catalog Number: USB-372444
Article Name: BETVIA, Recombinant, Betula Pendula, aa2-160, His-SUMO-Tag (Major Pollen Allergen Bet v 1-A)
Biozol Catalog Number: USB-372444
Supplier Catalog Number: 372444
Alternative Catalog Number: USB-372444-20,USB-372444-100
Manufacturer: US Biological
Category: Molekularbiologie
May be a general steroid carrier protein. Source: Recombinant protein corresponding to aa2-160 from betula pendula BETVIA, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33.4kD Amino Acid Sequence: GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 33.4
UniProt: P15494
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.