BglIIM, Recombinant, Bacillus Subtilis, aa1-360, His-SUMO-Tag (Modification Methylase BglII)

Catalog Number: USB-372447
Article Name: BglIIM, Recombinant, Bacillus Subtilis, aa1-360, His-SUMO-Tag (Modification Methylase BglII)
Biozol Catalog Number: USB-372447
Supplier Catalog Number: 372447
Alternative Catalog Number: USB-372447-20,USB-372447-100
Manufacturer: US Biological
Category: Molekularbiologie
This methylase recognizes the double-stranded sequence AGATCT, causes specific methylation on C-5 on both strands, and protects the DNA from cleavage by the BglII endonuclease. Source: Recombinant protein corresponding to aa1-360 from bacillus subtilis bglllM, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~58.0kD Amino Acid Sequence: MSEDQYKQIKLHLGMEDDNEDLPNHIPSSFPKQHLNKIYNGDTMNMLLDIPDNSVDLVVTSPPYNINKFKNDRRPLEEYLKWQTEIIEQCHRVLKPSGSIFWQVGTYVNDSGAHIPLDIRFFPIFESLGMFPRNRIVWVRPHGLHANKKFAGRHETILWFTKTPEYKFFLDPIRVPQKYANKKHYKGDKKGELSGDPLGKNPGDVWAFRNVRHNHEEDTIHPTQYPEDMIERIVLSTTEPNDIVLDPFIGMGTTASVAKNLNRYFYGAEIEKEYVDIAYQILSGEPDENNNFPNLKTLRQYCEKNGIIDPSQYTFTRQRKGSKPSLDSKAHPEEHHKKEIVERIEFEAENSVYKKVQNEQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 58
UniProt: Q45489
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.