BLID, Recombinant, Human, aa1-108, GST-Tag (BH3-like Motif-containing Cell Death Inducer)

Product Overview

• Article Name: BLID, Recombinant, Human, aa1-108, GST-Tag (BH3-like Motif-containing Cell Death Inducer)
• Biozol Catalog Number: USB-372454
• Supplier Catalog Number: 372454
• Alternative Catalog Number: USB-372454-20, USB-372454-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Functions as a proapoptotic molecule through the caspase-dependent mitochondrial pathway of cell death. Source: Recombinant protein corresponding to aa1-108 from human BLID, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.0kD Amino Acid Sequence: MVTLLPIEGQEIHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLPKETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 39
• UniProt: Q8IZY5
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.