BLLF3, Recombinant, Epstein-Barr Virus, aa1-278, His-SUMO-Tag (strain GD1) (HHV-4) DUTPase)

Catalog Number: USB-372455
Article Name: BLLF3, Recombinant, Epstein-Barr Virus, aa1-278, His-SUMO-Tag (strain GD1) (HHV-4) DUTPase)
Biozol Catalog Number: USB-372455
Supplier Catalog Number: 372455
Alternative Catalog Number: USB-372455-20,USB-372455-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa1-278 from Epstein-Barr virus BLFF3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~46.9kD Amino Acid Sequence: MEACPHIRYAFQNDKLLLQQASVGRLTLVNKTTILLRPMKTTTVDLGLYARPPEGHGLMLWGSTSRPVTSHVGIIDPGYTGELRLILQNQRRYNSTLRPSELKIHLAAFRYATPQMEEDKGPINHPQYPGDVGLDVSLPKDLALFPHQTVSVTLTVPPPSIPHHRPTIFGRSGLAMQGILVKPCRWRRGGVDVSLTNFSDQTVFLNKYRRFCQLVYLHKHHLTSFYSPHSDAGVLGPRSLFRWASCAFEEVPSLAMGDSGLSEALEGRQGRGFGSSGQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight: 46.9
UniProt: K9US42
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.