BLVRA, Recombinant, Human, aa1-296, GST-Tag (Biliverdin Reductase A)

Product Overview

• Article Name: BLVRA, Recombinant, Human, aa1-296, GST-Tag (Biliverdin Reductase A)
• Biozol Catalog Number: USB-372458
• Supplier Catalog Number: 372458
• Alternative Catalog Number: USB-372458-20, USB-372458-100, USB-372458-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Reduces the gamma-methene bridge of the open tetrapyrrole, biliverdin IX alpha, to bilirubin with the concomitant oxidation of a NADH or NADPH cofactor. Source: Recombinant protein corresponding to aa1-296 from human BLVRA, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~60.2kD Amino Acid Sequence: AEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 60.2
• UniProt: P53004
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.