BMP6, Recombinant, Human, aa382-513, His-Tag (Bone Morphogenetic Protein 6)

Catalog Number: USB-372464
Article Name: BMP6, Recombinant, Human, aa382-513, His-Tag (Bone Morphogenetic Protein 6)
Biozol Catalog Number: USB-372464
Supplier Catalog Number: 372464
Alternative Catalog Number: USB-372464-20, USB-372464-100, USB-372464-1
Manufacturer: US Biological
Category: Molekularbiologie
Induces cartilage and bone formation. Source: Recombinant protein corresponding to aa382-513 from human BMP6, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~18.9kD Amino Acid Sequence: QQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 18.9
UniProt: P22004
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.