BMP7, Recombinant, Human, aa293-431, GST-Tag (Bone Morphogenetic Protein 7)

Catalog Number: USB-372465
Article Name: BMP7, Recombinant, Human, aa293-431, GST-Tag (Bone Morphogenetic Protein 7)
Biozol Catalog Number: USB-372465
Supplier Catalog Number: 372465
Alternative Catalog Number: USB-372465-20, USB-372465-200
Manufacturer: US Biological
Category: Molekularbiologie
Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis. Source: Recombinant protein corresponding to aa293-431 from human BMP7, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.7kD Amino Acid Sequence: STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 42.7
UniProt: P18075
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.