BMPR1A, Recombinant, Human, aa177-532, His-SUMO-Tag (Bone Morphogenetic Protein Receptor Type-1A)

Catalog Number: USB-372467
Article Name: BMPR1A, Recombinant, Human, aa177-532, His-SUMO-Tag (Bone Morphogenetic Protein Receptor Type-1A)
Biozol Catalog Number: USB-372467
Supplier Catalog Number: 372467
Alternative Catalog Number: USB-372467-20,USB-372467-100,USB-372467-1
Manufacturer: US Biological
Category: Molekularbiologie
On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for BMP-2 and BMP-4. Positively regulates chondrocyte differentiation through GDF5 interaction. Source: Recombinant protein corresponding to aa177-532 from human BMPR1A, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~56.57kD Amino Acid Sequence: KHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKNHFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLRPIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 56.57
UniProt: P36894
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.