BTN2A2, Recombinant, Human, aa33-262, His-SUMO-Tag (Butyrophilin Subfamily 2 Member A2)
Biozol Catalog Number:
USB-372491
Supplier Catalog Number:
372491
Alternative Catalog Number:
USB-372491-20,USB-372491-100,USB-372491-1
Manufacturer:
US Biological
Category:
Molekularbiologie
Inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL2 and IFNG secretion. Source: Recombinant protein corresponding to aa33-262 from human BTN2A2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.7kD Amino Acid Sequence: QFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEAILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTAVIIRDKYVRNVSCSVNNTLLGQEKETVIFIPESFMPSASPWMVALAVILTAS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted