BTN3A2, Recombinant, Human, aa30-248, His-SUMO-Tag (Butyrophilin Subfamily 3 Member A2)

Catalog Number: USB-372494
Article Name: BTN3A2, Recombinant, Human, aa30-248, His-SUMO-Tag (Butyrophilin Subfamily 3 Member A2)
Biozol Catalog Number: USB-372494
Supplier Catalog Number: 372494
Alternative Catalog Number: USB-372494-20, USB-372494-100, USB-372494-1
Manufacturer: US Biological
Category: Molekularbiologie
Plays a role in T-cell responses in the adaptive immune response. Inhibits the release of IFNG from activated T-cells. Source: Recombinant protein corresponding to aa30-248 from human BTN3A2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.59kD Amino Acid Sequence: QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 39.59
UniProt: P78410
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.