BTN3A3, Recombinant. Human, aa30-248, His-SUMO-Tag (Butyrophilin Subfamily 3 Member A3)
Biozol Catalog Number:
USB-372497
Supplier Catalog Number:
372497
Alternative Catalog Number:
USB-372497-20,USB-372497-100,USB-372497-1
Manufacturer:
US Biological
Category:
Molekularbiologie
Plays a role in T-cell responses in the adaptive immune response. Recombinant protein corresponding to aa30-248 from human BTN3A3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.57kD Amino Acid Sequence: QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELRWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHIEVKGYEDGGIHLECRSTGWYPQPQIKWSDTKGENIPAVEAPVVADGVGLYAVAASVIMRGSSGGGVSCIIRNSLLGLEKTASISIADPFFRSAQPW Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted