Vitamin B12-Binding Protein, Recombinant, E. coli, aa24-266, GST-Tag (BtuF)

Product Overview

• Article Name: Vitamin B12-Binding Protein, Recombinant, E. coli, aa24-266, GST-Tag (BtuF)
• Biozol Catalog Number: USB-372498
• Supplier Catalog Number: 372498
• Alternative Catalog Number: USB-372498-20, USB-372498-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Part of the ABC transporter complex BtuCDF involved in vitamin B12 import. Binds vitamin B12 and delivers it to the periplasmic surface of BtuC. Source: Recombinant protein corresponding to aa24-266 from E. coli Vitamin B12-binding Protein, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~53.9kD Amino Acid Sequence: PRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 53.9
• UniProt: P37028
• Purity: ~90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.