Vitamin B12-Binding Protein, Recombinant, E. coli, aa24-266, His-Tag (BtuF)

Catalog Number: USB-372499
Article Name: Vitamin B12-Binding Protein, Recombinant, E. coli, aa24-266, His-Tag (BtuF)
Biozol Catalog Number: USB-372499
Supplier Catalog Number: 372499
Alternative Catalog Number: USB-372499-20,USB-372499-100
Manufacturer: US Biological
Category: Molekularbiologie
Part of the ABC transporter complex BtuCDF involved in vitamin B12 import. Binds vitamin B12 and delivers it to the periplasmic surface of BtuC. Source: Recombinant protein corresponding to aa24-266 from E. coli Vitamin B12-binding Protein, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~30.9kD Amino Acid Sequence: PRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 30.9
UniProt: P37028
Purity: ~90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.