BuXI, Recombinant, Bauhinia Ungulata, aa1-172, His-Tag (Factor Xa Inhibitor BuXI)

Product Overview

• Article Name: BuXI, Recombinant, Bauhinia Ungulata, aa1-172, His-Tag (Factor Xa Inhibitor BuXI)
• Biozol Catalog Number: USB-372502
• Supplier Catalog Number: 372502
• Alternative Catalog Number: USB-372502-20, USB-372502-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Inhibits bovine trypsin and chymotrypsin, and human plasmin, plasma kallikrein, factor XIIa and factor Xa. Source: Recombinant protein corresponding to aa1-172 from Bauhinia ungulata BuXI, fused toHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~23.2kD Amino Acid Sequence: DIVLDTDGKPVNNGGQYYIIPAFRGNGGGLELTRVGRETCPHTVVQASSEISNGLPVMIAALPRTMFISTAWRVSIQFLKVPTCTPKPSYWHIPQDSDMEGSVEVRVDERFPLEFRIEKVSEDAYKLMHCPSSSDSCRDLGIAIDEENNRRLVVRDGKPLLVRFKEANQDSE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Product Properties

• Molecular Weight: 23.2
• UniProt: P83594
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.