BuXI, Recombinant, Bauhinia Ungulata, aa1-172, His-Tag (Factor Xa Inhibitor BuXI)
Biozol Catalog Number:
USB-372503
Supplier Catalog Number:
372503
Alternative Catalog Number:
USB-372503-20,USB-372503-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Inhibits bovine trypsin and chymotrypsin, and human plasmin, plasma kallikrein, factor XIIa and factor Xa. Source: Recombinant protein corresponding to aa1-172 from bauhinia ungulata BuXI, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~21.2kD Amino Acid Sequence: DIVLDTDGKPVNNGGQYYIIPAFRGNGGGLELTRVGRETCPHTVVQASSEISNGLPVMIAALPRTMFISTAWRVSIQFLKVPTCTPKPSYWHIPQDSDMEGSVEVRVDERFPLEFRIEKVSEDAYKLMHCPSSSDSCRDLGIAIDEENNRRLVVRDGKPLLVRFKEANQDSE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted