C11orf73, Recombinant, Human, aa1-197, His-SUMO-Tag (Uncharacterized Protein C11orf73)

Catalog Number: USB-372505
Article Name: C11orf73, Recombinant, Human, aa1-197, His-SUMO-Tag (Uncharacterized Protein C11orf73)
Biozol Catalog Number: USB-372505
Supplier Catalog Number: 372505
Alternative Catalog Number: USB-372505-20,USB-372505-100,USB-372505-1
Manufacturer: US Biological
Category: Molekularbiologie
Acts as a specific nuclear import carrier for HSP70 proteins following heat-shock stress: acts by mediating the nucleoporin-dependent translocation of ATP-bound HSP70 proteins into the nucleus. HSP70 proteins import is required to protect cells from heat shock damages. Does not translocate ADP-bound HSP70 proteins into the nucleus. Source: Recombinant protein corresponding to aa1-197 from human C11orf73, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~37.6kD Amino Acid Sequence: MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWKT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 37.6
UniProt: Q53FT3
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.