C16orf80, Recombinant, Human, aa1-193. GST-Tag (UPF0468 Protein C16orf80)

Product Overview

• Article Name: C16orf80, Recombinant, Human, aa1-193. GST-Tag (UPF0468 Protein C16orf80)
• Biozol Catalog Number: USB-372507
• Supplier Catalog Number: 372507
• Alternative Catalog Number: USB-372507-20, USB-372507-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. Involved in the regulation of the size and morphology of cilia. Required for axonemal microtubules polyglutamylation. Source: Recombinant protein corresponding to aa1-193 from human C16orf80, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~49.8kD Amino Acid Sequence: MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 49.8
• UniProt: Q9Y6A4
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.