C19orf48, Recombinant, Human, aa1-117, GST-Tag (Uncharacterized Protein C19orf48)

Product Overview

• Article Name: C19orf48, Recombinant, Human, aa1-117, GST-Tag (Uncharacterized Protein C19orf48)
• Biozol Catalog Number: USB-372508
• Supplier Catalog Number: 372508
• Alternative Catalog Number: USB-372508-20, USB-372508-100, USB-372508-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa1-117 from human C19orf48, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~40.1kD Amino Acid Sequence: MTVLEAVLEIQAITGSRLLSMVPGPARPPGSCWDPTQCTRTWLLSHTPRRRWISGLPRASCRLGEEPPPLPYCDQAYGEELSIRHRETWAWLSRTDTAWPGAPGVKQARILGELLLV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 40.1
• UniProt: Q6RUI8
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.