C3, Recombinant, Rat, aa671-746, His-Tag (Complement C3)
Biozol Catalog Number:
USB-372519
Supplier Catalog Number:
372519
Alternative Catalog Number:
USB-372519-20,USB-372519-100
Manufacturer:
US Biological
Category:
Molekularbiologie
C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates. Source: Recombinant protein corresponding to aa671-746 from rat C3, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~11kD Amino Acid Sequence: SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMPYSCQRRARLITQGESCLKAFMDCCNYITKLREQHRRDHVLGL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted