Ca1, Recombinant, Rat, aa2-261, His-Tag (Carbonic Anhydrase 1)

Product Overview

• Article Name: Ca1, Recombinant, Rat, aa2-261, His-Tag (Carbonic Anhydrase 1)
• Biozol Catalog Number: USB-372529
• Supplier Catalog Number: 372529
• Alternative Catalog Number: USB-372529-20,USB-372529-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Reversible hydration of carbon dioxide. Source: Recombinant protein corresponding to aa2-261 from rat Carbonic Anhydrase 1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~30.2kD Amino Acid Sequence: ASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 30.2
• UniProt: B0BNN3
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.