CACNA2D1, Recombinant, Human, aa528-668, His-SUMO-Tag (Voltage-dependent Calcium Channel Subunit alpha-2/delta-1)

Catalog Number: USB-372533
Article Name: CACNA2D1, Recombinant, Human, aa528-668, His-SUMO-Tag (Voltage-dependent Calcium Channel Subunit alpha-2/delta-1)
Biozol Catalog Number: USB-372533
Supplier Catalog Number: 372533
Alternative Catalog Number: USB-372533-20,USB-372533-100,USB-372533-1
Manufacturer: US Biological
Category: Molekularbiologie
The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Plays an important role in excitation-contraction coupling. Source: Recombinant protein corresponding to aa528-668 from human CACNA2D1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~32.3kD Amino Acid Sequence: QPKPIGVGIPTINLRKRRPNIQNPKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARYSETLKPDNFEESGYTFIAPRDY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 32.3
UniProt: P54289
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.