F1 Capsule Antigen, Recombinant, Yersinia Pestis, aa22-170, His-Tag (Caf1)

Catalog Number: USB-372536
Article Name: F1 Capsule Antigen, Recombinant, Yersinia Pestis, aa22-170, His-Tag (Caf1)
Biozol Catalog Number: USB-372536
Supplier Catalog Number: 372536
Alternative Catalog Number: USB-372536-20, USB-372536-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa22-170 from yersinia pestis F1 Capsule Antigen, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.6kD Amino Acid Sequence: ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 17.6
UniProt: P26948
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in Tris, 50% glycerol.