CALML3, Recombinant, Human, aa1-149, GST-Tag (Calmodulin-like Protein 3, CaM-like Protein)

Product Overview

• Article Name: CALML3, Recombinant, Human, aa1-149, GST-Tag (Calmodulin-like Protein 3, CaM-like Protein)
• Biozol Catalog Number: USB-372544
• Supplier Catalog Number: 372544
• Alternative Catalog Number: USB-372544-20,USB-372544-100,USB-372544-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

May function as a specific light chain of unconventional myosin-10 (MYO10), also enhances MYO10 translation, possibly by acting as a chaperone for the emerging MYO10 heavy chain protein. May compete with calmodulin by binding, with different affinities, to cellular substrates. Source: Recombinant protein corresponding to aa1-149 from full length human CALML3, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~43.9kD Amino Acid Sequence: MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 43.9
• UniProt: P27482
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.