Calreticulin, Recombinant, Mouse, aa18-416, GST-Tag (Calr)

Catalog Number: USB-372553
Article Name: Calreticulin, Recombinant, Mouse, aa18-416, GST-Tag (Calr)
Biozol Catalog Number: USB-372553
Supplier Catalog Number: 372553
Alternative Catalog Number: USB-372553-20,USB-372553-100
Manufacturer: US Biological
Category: Molekularbiologie
Calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis. Recombinant protein corresponding to aa18-416 from mouse Calreticulin, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~73.7kD Amino Acid Sequence: DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 73.7
UniProt: P14211
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in PBS, pH 7.4, 50% glycerol