Carbon Storage Regulator, Recombinant, E. coli, aa1-61, His-SUMO-Tag (CsrA)

Catalog Number: USB-372569
Article Name: Carbon Storage Regulator, Recombinant, E. coli, aa1-61, His-SUMO-Tag (CsrA)
Biozol Catalog Number: USB-372569
Supplier Catalog Number: 372569
Alternative Catalog Number: USB-372569-20,USB-372569-100
Manufacturer: US Biological
Category: Molekularbiologie
Affects glycogen biosynthesis, gluconeogenesis, cell size and surface properties. Regulates glycogen synthesis under both aerobic and anaerobic conditions. Seems to accelerate the degradation of glg gene transcripts, potentially through selective RNA binding. Acts to inhibit interaction between the LetD protein and the A subunit of DNA gyrase. Also required for motility and flagellum biosynthesis through the post-transcriptional activation of flhDC expression. This involves binding to and stabilization of the flhDC message by CsrA. Source: Recombinant protein corresponding to aa1-61 from E. coli Carbon Storage Regulator, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~22.9kD Amino Acid Sequence: MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQQSSY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 22.9
UniProt: B1XCM4
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.