Carbonic Anhydrase 1, Recombinant, Human, aa2-261, His-SUMO-Tag (CA1)

Catalog Number: USB-372570
Article Name: Carbonic Anhydrase 1, Recombinant, Human, aa2-261, His-SUMO-Tag (CA1)
Biozol Catalog Number: USB-372570
Supplier Catalog Number: 372570
Alternative Catalog Number: USB-372570-20,USB-372570-100,USB-372570-1
Manufacturer: US Biological
Category: Molekularbiologie
Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea. Source: Recombinant protein corresponding to aa2-261 from human Carbonic Anhydrase 1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~44.7kD Amino Acid Sequence: ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 44.7
UniProt: P00915
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.