CASP1, Recombinant, Human, aa120-269, GST-Tag (Caspase-1)

Catalog Number: USB-372578
Article Name: CASP1, Recombinant, Human, aa120-269, GST-Tag (Caspase-1)
Biozol Catalog Number: USB-372578
Supplier Catalog Number: 372578
Alternative Catalog Number: USB-372578-20,USB-372578-100,USB-372578-1
Manufacturer: US Biological
Category: Molekularbiologie
Thiol protease that cleaves IL-1 beta between an Asp and an Ala, releasing the mature cytokine which is involved in a variety of inflammatory processes. Important for defense against pathogens. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Can also promote apoptosis. Source: Partial recombinant protein corresponding to aa120-269 from human CASP1, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~43.8kD Amino Acid Sequence: NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 43.8
UniProt: P29466
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.