Cathepsin K, Recombinant, Macaca Fascicularis, aa115-329, His-Tag (CTSK)

Catalog Number: USB-372594
Article Name: Cathepsin K, Recombinant, Macaca Fascicularis, aa115-329, His-Tag (CTSK)
Biozol Catalog Number: USB-372594
Supplier Catalog Number: 372594
Alternative Catalog Number: USB-372594-20,USB-372594-100
Manufacturer: US Biological
Category: Molekularbiologie
Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in Extracellular domain matrix degradation. Recombinant protein corresponding to aa115-329 from Macaca Fascicularis Cathepsin K, fused to 6XHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.5kD Amino Acid Sequence: APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight: 27.5
UniProt: P61276
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.