CBR4, Recombinant, Human, aa1-237, GST-Tag (Carbonyl Reductase Family Member 4)

Product Overview

• Article Name: CBR4, Recombinant, Human, aa1-237, GST-Tag (Carbonyl Reductase Family Member 4)
• Biozol Catalog Number: USB-372607
• Supplier Catalog Number: 372607
• Alternative Catalog Number: USB-372607-20,USB-372607-100,USB-372607-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

The heterotetramer with HSD17B8 has NADH-dependent 3-ketoacyl-acyl carrier protein reductase activity, and thereby plays a role in mitochondrial fatty acid biosynthesis. Within the heterotetramer, HSD17B8 binds NADH, CBR4 binds NADPD. The homotetramer has NADPH-dependent quinone reductase activity. Both homotetramer and the heterotetramer have broad substrate specificity and can reduce 9,10-phenanthrenequinone, 1,4-benzoquinone and various other o-quinones and p-quinones. Recombinant protein corresponding to aa1-237 from full length human CBR4, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~52.3kD Amino Acid Sequence: MDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKEEHLKKNIPLGRFGETIEVAHAVVFLLESPYITGHVLVVDGGLQLIL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 52.3
• UniProt: Q8N4T8
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.