CBX7, Recombinant, Human, aa1-251, His-Tag (Chromobox Protein Homolog 7)

Catalog Number: USB-372609
Article Name: CBX7, Recombinant, Human, aa1-251, His-Tag (Chromobox Protein Homolog 7)
Biozol Catalog Number: USB-372609
Supplier Catalog Number: 372609
Alternative Catalog Number: USB-372609-20,USB-372609-100,USB-372609-1
Manufacturer: US Biological
Category: Molekularbiologie
Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, it mediates monoubiquitination of histone H2A Lys-119, rendering chromatin heritably changed in its expressibility. Promotes histone H3 trimethylation at Lys-9 (H3K9me3). Binds to trimethylated lysine residues in histones, and possibly also other proteins. Regulator of cellular lifespan by maintaining the repression of CDKN2A, but not by inducing telomerase activity. Recombinant protein corresponding to aa1-251 from full length human Chromobox Protein Homolog 7, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~32.3kD Amino Acid Sequence: MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 32.3
UniProt: O95931
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in 10mM Tris-HCl, 1mM EDTA, pH 8.0, 50% glycerol