CCL7, Recombinant, Mouse, aa28-97, His-Tag (C-C Motif Chemokine 7)

Catalog Number: USB-372641
Article Name: CCL7, Recombinant, Mouse, aa28-97, His-Tag (C-C Motif Chemokine 7)
Biozol Catalog Number: USB-372641
Supplier Catalog Number: 372641
Alternative Catalog Number: USB-372641-20,USB-372641-100
Manufacturer: US Biological
Category: Molekularbiologie
Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity. Source: Recombinant protein corresponding to aa28-97 from mouse C-C Motif Chemokine 7, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~12.1kD Amino Acid Sequence: PNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 12.1
UniProt: Q03366
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.