CCL8, Recombinant, Human, aa24-99, His-Tag (C-C Motif Chemokine 8)

Catalog Number: USB-372643
Article Name: CCL8, Recombinant, Human, aa24-99, His-Tag (C-C Motif Chemokine 8)
Biozol Catalog Number: USB-372643
Supplier Catalog Number: 372643
Alternative Catalog Number: USB-372643-20, USB-372643-100
Manufacturer: US Biological
Category: Molekularbiologie
Chemotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils. May play a role in neoplasia and inflammatory host responses. This protein can bind heparin. The processed form MCP-2(6-76) does not show monocyte chemotactic activity, but inhibits the chemotactic effect most predominantly of CCL7, and also of CCL2 and CCL5 and CCL8. Source: Recombinant protein corresponding to aa24-99 from human CCL8, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~10.9kD Amino Acid Sequence: QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 10.9
UniProt: P80075
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.