CCR5, Recombinant, Mouse, aa263-354, His-Tag (C-C Chemokine Receptor Type 5)

Product Overview

• Article Name: CCR5, Recombinant, Mouse, aa263-354, His-Tag (C-C Chemokine Receptor Type 5)
• Biozol Catalog Number: USB-372649
• Supplier Catalog Number: 372649
• Alternative Catalog Number: USB-372649-20,USB-372649-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Receptor for a number of inflammatory CC-chemokines including MIP-1-alpha, MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation (By similarity). Source: Recombinant protein corresponding to aa263-354 from mouse Ccr5, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~12.56kD Amino Acid Sequence: QEFFGLNNCSSSNRLDQAMQATETLGMTHCCLNPVIYAFVGEKFRSYLSVFFRKHMVKRFCKRCSIFQQDNPDRASSVYTRSTGEHEVSTGL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 12.56
• UniProt: P51682
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.