Signal Transducer CD24, Recombinant, Human, aa27-80, GST-Tag (CD24)

Product Overview

• Article Name: Signal Transducer CD24, Recombinant, Human, aa27-80, GST-Tag (CD24)
• Biozol Catalog Number: USB-372660
• Supplier Catalog Number: 372660
• Alternative Catalog Number: USB-372660-20, USB-372660-200
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Modulates B-cell activation responses. Signaling could be triggered by the binding of a lectin-like ligand to the CD24 carbohydrates, and transduced by the release of second messengers derived from the GPI-anchor. Promotes AG-dependent proliferation of B-cells, and prevents their terminal differentiation into antibody-forming cells. Source: Recombinant protein corresponding to aa27-80 from human CD24, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~32.3kD Amino Acid Sequence: SETTTGTSSNSSQSTSNTGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 32.3
• UniProt: P25063
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.