CD320 Antigen, Recombinant, Human, aa36-231, GST-Tag (CD320)

Catalog Number: USB-372664
Article Name: CD320 Antigen, Recombinant, Human, aa36-231, GST-Tag (CD320)
Biozol Catalog Number: USB-372664
Supplier Catalog Number: 372664
Alternative Catalog Number: USB-372664-20,USB-372664-100,USB-372664-1
Manufacturer: US Biological
Category: Molekularbiologie
Germinal center-B (GC-B) cells differentiate into mory B-cells and plasma cells (PC) through interaction with T-cells and follicular dendritic cells (FDC). CD320 augments the proliferation of PC precursors generated by IL-10. Receptor for the cellular uptake of transcobalamin bound cobalamin. Source: Recombinant protein corresponding to aa36-231 from human CD320, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~47.1kD Amino Acid Sequence: SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 47.1
UniProt: Q9NPF0
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.