CD40 Ligand, Recombinant, Rabbit, aa113-261, His-Tag (CD40LG)

Catalog Number: USB-372669
Article Name: CD40 Ligand, Recombinant, Rabbit, aa113-261, His-Tag (CD40LG)
Biozol Catalog Number: USB-372669
Supplier Catalog Number: 372669
Alternative Catalog Number: USB-372669-20, USB-372669-100
Manufacturer: US Biological
Category: Molekularbiologie
Mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL-4. Involved in immunoglobulin class switching. Source: Partial recombinant protein corresponding to aa113-261 from rabbit CD40 Ligand, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~20.2kD Amino Acid Sequence: MQKGDQDPQIAAHLISEASSKSSSVLQWAKKGYYTMSNTLVTLENGKQLKVKRQGFYYIYAQVTFCSNQEPSSQAPFIASLCLKSSGGSERILLRAANARSSSKTCEQQSIHLGGVFELQADASVFVNVTDASQVNHGTGFTSFGLLKL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight: 20.2
UniProt: G1SKP7
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.