CD59, Recombinant, Human, aa26-102, His-Tag (CD59 Glycoprotein)

Catalog Number: USB-372677
Article Name: CD59, Recombinant, Human, aa26-102, His-Tag (CD59 Glycoprotein)
Biozol Catalog Number: USB-372677
Supplier Catalog Number: 372677
Alternative Catalog Number: USB-372677-20,USB-372677-100
Manufacturer: US Biological
Category: Molekularbiologie
Potent inhibitor of the complement membrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complements of the assembling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase. The soluble form from urine retains its specific complement binding activity, but exhibits greatly reduced ability to inhibit MAC assembly on cell membranes. Source: Recombinant protein corresponding to aa26-102 from human CD59, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~11kD AA Sequence: LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 11
UniProt: P13987
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.