CD81, Recombinant, Human, aa113-201, His-SUMO-Tag

Catalog Number: USB-372684
Article Name: CD81, Recombinant, Human, aa113-201, His-SUMO-Tag
Biozol Catalog Number: USB-372684
Supplier Catalog Number: 372684
Alternative Catalog Number: USB-372684-20,USB-372684-100,USB-372684-1
Manufacturer: US Biological
Category: Molekularbiologie
May play an important role in the regulation of lymphoma cell growth. Interacts with a 16kD Leu-13 protein to form a complex possibly involved in signal transduction. May act as the viral receptor for HCV. Source: Recombinant protein corresponding to aa113-201 from human CD81, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~25.8kD Amino Acid Sequence: FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 25.8
UniProt: P60033
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.