CD8A, Recombinant, Bovine, aa26-189, His-SUMO-Tag (T-cell Surface Glycoprotein CD8 alpha Chain)

Catalog Number: USB-372688
Article Name: CD8A, Recombinant, Bovine, aa26-189, His-SUMO-Tag (T-cell Surface Glycoprotein CD8 alpha Chain)
Biozol Catalog Number: USB-372688
Supplier Catalog Number: 372688
Alternative Catalog Number: USB-372688-20,USB-372688-100
Manufacturer: US Biological
Category: Molekularbiologie
Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains. Source: Recombinant protein corresponding to aa26-189 from bovine CD8A, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33.9kD Amino Acid Sequence: LSFRMSPTQKETRLGEKVELQCELLQSGMATGCSWLRHIPGDDPRPTFLMYLSAQRVKLAEGLDPRHISGAKVSGTKFQLTLSSFLQEDQGYYFCSVVSNSILYFSNFVPVFLPAKPATTPAMRPSSAAPTSAPQTRSVSPRSEVCRTSAGSAVDTSRLDFACN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight: 33.9
UniProt: P31783
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.