CDA2, Recombinant, Saccharomyces cerevisiae, aa26-312, His-Tag (Chitin Deacetylase 2)

Catalog Number: USB-372690
Article Name: CDA2, Recombinant, Saccharomyces cerevisiae, aa26-312, His-Tag (Chitin Deacetylase 2)
Biozol Catalog Number: USB-372690
Supplier Catalog Number: 372690
Alternative Catalog Number: USB-372690-20,USB-372690-100
Manufacturer: US Biological
Category: Molekularbiologie
Hydrolyzes the N-acetamido groups of N-acetyl-D-glucosamine residues in chitin. Recombinant protein corresponding to aa26-312 from S. cerevisiae CDA2, fused to 6X His-Tag at N-terminal, expressed in Yeast. Swiss/UniProt Accession: Q06703. Molecular Weight: ~40kD Amino Acid Sequence: EANREDLKQIDFQFPVLERAATKTPFPDWLSAFTGLKEWPGLDPPYIPLDFIDFSQIPDYKEYDQNHCDSVPRDSCSFDCHHCTEHDDVYTCSKLSQTFDDGPSASTTKLLDRLKHNSTFFNLGVNIVQHPDIYQRMQKEGHLIGSHTWSHVYLPNVSNEKIIAQIEWSIWAMNATGNHTPKWFRPPYGGIDNRVRAITRQFGLQAVLWDHDTFDWSLLLNDSVITEQEILQNVINWNKSGTGLILEHDSTEKTVDLAIKINKLIGDDQSTVSHCVGGIDYIKEFLS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O, 5-50% glycerol. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 40
UniProt: Q06703
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder frrom 20mM Tris-HCl, 0.5M sodium chloride, 6% Trehalose, pH8, Reconstitute with sterile ddH2O, 5-50% glycerol to 0.1-1mg/ml.