CDKB12, Recombinant, Arabidopsis thaliana, aa1-311, His-Tag (Cyclin-dependent Kinase B1-2)

Catalog Number: USB-372702
Article Name: CDKB12, Recombinant, Arabidopsis thaliana, aa1-311, His-Tag (Cyclin-dependent Kinase B1-2)
Biozol Catalog Number: USB-372702
Supplier Catalog Number: 372702
Alternative Catalog Number: USB-372702-20, USB-372702-100
Manufacturer: US Biological
Category: Molekularbiologie
ATP + a protein = ADP + a phosphoprotein. ATP + [DNA-directed RNA polymerase] = ADP + [DNA-directed RNA polymerase] phosphate. Source: Recombinant protein corresponding to aa1-311 from arabidopsis thaliana CDKB1-2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~37.6kD Amino Acid Sequence: MEKYEKLEKVGEGTYGKVYKAMEKTTGKLVALKKTRLEMDEEGIPPTALREISLLQMLSQSIYIVRLLCVEHVIQSKDSTVSHSPKSNLYLVFEYLDTDLKKFIDSHRKGSNPRPLEASLVQRFMFQLFKGVAHCHSHGVLHRDLKPQNLLLDKDKGILKIADLGLSRAFTVPLKAYTHEIVTLWYRAPEVLLGSTHYSTAVDIWSVGCIFAEMIRRQALFPGDSEFQQLLHIFRLLGTPTEQQWPGVMALRDWHVYPKWEPQDLSRAVPSLSPEGIDLLTQMLKYNPAERISAKAALDHPYFDSLDKSQF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 37.6
UniProt: Q2V419
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.