CDKN2D, Recombinant, Human, aa1-166, GST-Tag (Cyclin-dependent Kinase 4 Inhibitor D)

Catalog Number: USB-372705
Article Name: CDKN2D, Recombinant, Human, aa1-166, GST-Tag (Cyclin-dependent Kinase 4 Inhibitor D)
Biozol Catalog Number: USB-372705
Supplier Catalog Number: 372705
Alternative Catalog Number: USB-372705-20,USB-372705-100
Manufacturer: US Biological
Category: Molekularbiologie
Interacts strongly with CDK4 and CDK6 and inhibits them. Source: Recombinant protein corresponding to aa1-166 from human CDKN2D, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~44.7kD Amino Acid Sequence: MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 44.7
UniProt: P55273
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.