CDO1, Recombinant, Human, aa1-200, GST-Tag (Cysteine Dioxygenase Type 1)

Product Overview

• Article Name: CDO1, Recombinant, Human, aa1-200, GST-Tag (Cysteine Dioxygenase Type 1)
• Biozol Catalog Number: USB-372706
• Supplier Catalog Number: 372706
• Alternative Catalog Number: USB-372706-20, USB-372706-100, USB-372706-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Initiates several important metabolic pathways related to pyruvate and several sulfurate compounds including sulfate, hypotaurine and taurine. Critical regulator of cellular cysteine concentrations. Has an important role in maintaining the hepatic concentation of intracellular free cysteine within a proper narrow range. Source: Recombinant protein corresponding to aa1-200 from human CDO1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~50kD Amino Acid Sequence: MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 50
• UniProt: Q16878
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.