CEBPG, Recombinant, Human, aa1-150, GST-Tag (CCAAT/Enhancer-binding Protein gamma)
Biozol Catalog Number:
USB-372713
Supplier Catalog Number:
372713
Alternative Catalog Number:
USB-372713-20, USB-372713-100, USB-372713-1
Manufacturer:
US Biological
Category:
Molekularbiologie
Transcription factor that binds to the promoter and the enhancer regions of target genes. Binds to the enhancer element PRE-I (positive regulatory element-I) of the IL-4 gene. Binds to the promoter and the enhancer of the immunoglobulin heavy chain. Binds to GPE1, a cis-acting element in the G-CSF gene promoter. Full-length recombinant protein corresponding to aa1-150 from human CEBPG, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~43.4kD Amino Acid Sequence: MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted